General Information

  • ID:  hor005325
  • Uniprot ID:  C0HKS0
  • Protein name:  Allatostatin-C
  • Gene name:  NA
  • Organism:  Agrotis ipsilon (Black cutworm moth)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  In its non-pyroglutamate form, expressed in antennal lobe (AL), corpora cardiaca (CC), corpora allata (CA) and gnathal ganglion (GNG) with expression in AL detected in most animals and expression in CC, CA and GNG detected in few animals (at protein level
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrotis (genus), Noctuini (tribe), Noctuinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVRFRQCYFNPISCF
  • Length:  15(22-36)
  • Propeptide:  MRRALDGPGSSSLDTRQADKRQVRFRQCYFNPISCFRK
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Strongly inhibits juvenile hormone biosynthesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HKS0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005325_AF2.pdbhor005325_ESM.pdb

Physical Information

Mass: 215811 Formula: C87H126N24O21S2
Absent amino acids: ADEGHKLMTW Common amino acids: F
pI: 8.8 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -7.33 Boman Index: -3064
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 45.33
Instability Index: 3193.33 Extinction Coefficient cystines: 1615
Absorbance 280nm: 115.36

Literature

  • PubMed ID:  29466015
  • Title:  Mating-Induced Differential Peptidomics of Neuropeptides and Protein Hormones in Agrotis Ipsilon Moths